PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi012920
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family G2-like
Protein Properties Length: 421aa    MW: 45208.3 Da    PI: 7.4774
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Picea_sitchensis-20046PU_refplantGDBView CDS
gnl|UG|Psi#S55420662PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.81.2e-3347101155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                k+rlrWtpeLH+rFv+av++LGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Psi012920  47 KQRLRWTPELHQRFVDAVTELGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 101
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.42944104IPR017930Myb domain
SuperFamilySSF466892.69E-1746102IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-3246102IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-2547102IPR006447Myb domain, plants
PfamPF002491.6E-949100IPR001005SANT/Myb domain
PfamPF143795.7E-23133179IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MYNARKYPAV SLMPPRSQGP EQHIASAVPI TSNNANCSPV ASGMASKQRL RWTPELHQRF  60
VDAVTELGGP DRATPKGVLR VMGVQGLTIY HVKSHLQKYR LSKYLPDSMG DGLKSEKKES  120
TDILSNLDAA SGVQISEALQ MQMEVQKRLH EQIEVQRQLQ LRIEAQGKYL QKIIEEQQRL  180
SGALKDGTTS ASFSLPACTG QPEQASDLKP DPSNLIPMPV ASQDGGGTGG ASSSVAKHSL  240
NCLSHDESPS FSSQQGPPSP DSLGDDESSS GANSPLESPR SGKPPQKKPR LDIMSASSDQ  300
QVCKQSEKER AGFDAESLSG SSFQHRDSRP LILNSHHQLP DSHTGLHPFR PSQTAGSAAA  360
LPTSPTSQPR NQLLSQTKHA VSSEMSASAH MLQQSSRDAF YPFNSASSMT DLQEGSGHAS  420
G
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008786820.15e-88PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_008788479.11e-87PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_015901105.12e-87PREDICTED: myb family transcription factor APL
TrEMBLD5ACF50.0D5ACF5_PICSI; Putative uncharacterized protein
STRINGVIT_00s0475g00040.t012e-84(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-80G2-like family protein